PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7KG339400.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 245aa    MW: 28217.2 Da    PI: 9.3392
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7KG339400.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF84.37.2e-27959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         k+ien +nrqvtfskRr g++KKA+EL +LCda++ viifs +g++yeyss
  Pavir.7KG339400.2.p  9 KKIENPTNRQVTFSKRRMGLFKKANELAILCDAQIGVIIFSGSGRMYEYSS 59
                         68***********************************************96 PP

2K-box53.11.4e-18851601489
                K-box  14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqe 89 
                          +++  qe++++k+e + L+    h++GedL s s+++L +Leqq+e sl k R +K+ell +q+ e+ ++e  ++ 
  Pavir.7KG339400.2.p  85 QQKIIQEMTRMKDERNRLRIIMGHYMGEDLASFSVEDLSNLEQQMEFSLYKLRLRKQELLDQQLLEMHHREMHMHM 160
                          68899******************************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.357161IPR002100Transcription factor, MADS-box
SMARTSM004324.4E-39160IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.32E-30279IPR002100Transcription factor, MADS-box
CDDcd002653.94E-39276No hitNo description
PRINTSPR004041.2E-27323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.8E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-273859IPR002100Transcription factor, MADS-box
PfamPF014862.2E-1581160IPR002487Transcription factor, K-box
PROSITE profilePS5129712.01185171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MGRGKVELKK IENPTNRQVT FSKRRMGLFK KANELAILCD AQIGVIIFSG SGRMYEYSSP  60
PWRIANIFDR YLKAPSTRFE EMDIQQKIIQ EMTRMKDERN RLRIIMGHYM GEDLASFSVE  120
DLSNLEQQME FSLYKLRLRK QELLDQQLLE MHHREMHMHM PEEQSSYLCL MNPAARGQSQ  180
AANPRPFPAT AWWWDVGASA SGSGSQRSNG RDAEPSVTAL QLHGYRLQPR QPNLQDASSL  240
HGWL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P7e-17160160Myocyte-specific enhancer factor 2B
1tqe_Q7e-17160160Myocyte-specific enhancer factor 2B
1tqe_R7e-17160160Myocyte-specific enhancer factor 2B
1tqe_S7e-17160160Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976800.11e-142PREDICTED: MADS-box transcription factor 31-like
SwissprotQ84NC24e-92MAD31_ORYSJ; MADS-box transcription factor 31
TrEMBLA0A096S8I01e-138A0A096S8I0_MAIZE; Uncharacterized protein
STRINGGRMZM2G070151_P021e-136(Zea mays)
STRINGGRMZM2G135018_P011e-138(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.29e-42MIKC_MADS family protein